PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8192_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 553aa    MW: 62088.7 Da    PI: 7.0081
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8192_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.5e-084685061854
                                          HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                          +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  cra_locus_8192_iso_1_len_3048_ver_3 468 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 506
                                          5887779******************************88 PP

2BELL74.41.8e-24341409372
                                 BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                           e++ kk +Ll+ll+ Vd++Y+q+ ++++tv+++F+av++l++  +++++Alk+iS  +++L+++i+++i
  cra_locus_8192_iso_1_len_3048_ver_3 341 LEVETKKKHLLDLLQVVDDQYSQCLDEIHTVVAAFHAVTELNP-DIHARFALKTISTLYKSLRERISNHI 409
                                          5899***************************************.***********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-24274407IPR006563POX domain
PfamPF075264.9E-25280406IPR006563POX domain
PROSITE profilePS5007111.143447510IPR001356Homeobox domain
CDDcd000867.20E-11450511No hitNo description
SMARTSM003897.5E-6450514IPR001356Homeobox domain
SuperFamilySSF466892.82E-15452519IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-25453516IPR009057Homeodomain-like
PfamPF059208.8E-15467506IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MAEPSSIVTE GIPFHTNFTP LNSPDLMVLN NRDQAVNGFP GPLTVHGDEN NLEASAHGTI  60
LGRISDSYPT GIVSLERYIS RDLLYGTPYP TSVETKGRYM EGMPLSAASL SNLCIPHETL  120
NRYASSTPLI YPSDVPGNVN PSDDSNTSND NVPTHSSTRW DFNNYVLHPE PSGKVLGRTT  180
LQPFGIMQTV DPGRWVGSQN TSLSSDSPRS SRLSNELSLS LATSNPSVLC RNSIQDHCSE  240
ICGSSTSPYE RCLGSEQTSC SRKTSLSFGS SKPIQISQLL SGSLYLHAIQ EILSEVAFYA  300
LGNHDQMNYS TFGFEDQENA SLSSTCAAKV TIEADPMMQQ LEVETKKKHL LDLLQVVDDQ  360
YSQCLDEIHT VVAAFHAVTE LNPDIHARFA LKTISTLYKS LRERISNHIL ALGVYCSKEV  420
ARKEGKSFET SFIQKQFALQ QLKRKDNQIW RPQRGLPERS VSVLRAWMFQ NFLHPYPKDA  480
EKHLLAVKSG LTRSQVSNWF INARVRLWKP MMEEMYAEMN RRKNHQTDEE TNHNNSNSQR  540
NRIRINNQRF AMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-14456514563Homeobox protein Meis2
3k2a_B3e-14456514563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278796.31e-167PREDICTED: homeobox protein ATH1
RefseqXP_010648330.11e-167PREDICTED: homeobox protein ATH1
RefseqXP_010648331.11e-167PREDICTED: homeobox protein ATH1
RefseqXP_010648332.11e-167PREDICTED: homeobox protein ATH1
SwissprotP487311e-104ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A068UKX60.0A0A068UKX6_COFCA; Uncharacterized protein
STRINGVIT_04s0008g00880.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327